PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016502110.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 88aa    MW: 10671.3 Da    PI: 8.7899
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016502110.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding29.32e-093271445
                     S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                     ++++E++l+++ +k+ G + W +Ia +++ gRt++++  +w 
   XP_016502110.1 32 MSKQEEDLIYRMHKLVGDR-WGLIAGRIP-GRTAEEIERFWI 71
                     689**************99.*********.*********995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007177.6E-72876IPR001005SANT/Myb domain
CDDcd001671.52E-63170No hitNo description
PfamPF002491.1E-83271IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.3E-113371IPR009057Homeodomain-like
PROSITE profilePS500906.1443370IPR017877Myb-like domain
SuperFamilySSF466893.51E-83372IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010091Biological Processtrichome branching
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 88 aa     Download sequence    Send to blast
MDQNLHHQPK LMHHRCCSHE EVNSMEWEFI SMSKQEEDLI YRMHKLVGDR WGLIAGRIPG  60
RTAEEIERFW IMKHSDGFAN KRRQLRKV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2389263e-34AC238926.5 Solanum lycopersicum strain Heinz 1706 chromosome 1 clone hba-330o5 map 1, complete sequence.
GenBankHG9754403e-34HG975440.1 Solanum pennellii chromosome ch01, complete genome.
GenBankHG9755133e-34HG975513.1 Solanum lycopersicum chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009761639.14e-61PREDICTED: MYB-like transcription factor ETC3
RefseqXP_009623671.14e-61PREDICTED: MYB-like transcription factor ETC3
RefseqXP_016502110.14e-61PREDICTED: MYB-like transcription factor ETC3
RefseqXP_016464336.14e-61PREDICTED: MYB-like transcription factor ETC3
SwissprotQ8GV055e-34TRY_ARATH; Transcription factor TRY
TrEMBLK4AZV35e-52K4AZV3_SOLLC; Uncharacterized protein
STRINGSolyc01g095640.1.11e-51(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA117071824
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53200.13e-35MYB_related family protein